General Information

  • ID:  hor005247
  • Uniprot ID:  P0C228
  • Protein name:  Gastrin-16
  • Gene name:  GAST
  • Organism:  Macropus giganteus (Eastern gray kangaroo)
  • Family:  Gastrin/cholecystokinin family
  • Source:  animal
  • Expression:  NA
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Macropus (genus), Macropodidae (family), Diprotodontia (order), Metatheria, Theria, Mammalia (class), Amniota, Tetrapoda, Dipnotetrapodomorpha, Sarcopterygii (superclass), Euteleostomi, Teleostomi, Gnathostomata, Vertebrata, Craniata (subphylum), Chordata (phylum), Deuterostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0005179 hormone activity
  • GO BP:  GO:0007165 signal transduction
  • GO CC:  GO:0005576 extracellular region

Sequence Information

  • Sequence:  KGPWQEEDAAYGWMDF
  • Length:  16
  • Propeptide:  QLHPQDLPHLMTDLSKKKGPWQEEDAAYGWMDF
  • Signal peptide:  NA
  • Modification:  T11 Sulfotyrosine;T16 Phenylalanine amide
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  Gastrin stimulates the stomach mucosa to produce and secrete hydrochloric acid and the pancreas to secrete its digestive enzymes. It also stimulates smooth muscle contraction and increases blood circulation and water secretion in the stomach and intestine.
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:  NA
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-P0C228-F1(AlphaFold_DB_ID)

  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
    •    hor005247_AF2.pdbhor005247_ESM.pdb

Physical Information

Mass: 219782 Formula: C89H116N20O27S
Absent amino acids: CHILNRSTV Common amino acids: ADEGW
pI: 3.74 Basic residues: 1
Polar residues: 3 Hydrophobic residues: 5
Hydrophobicity: -116.25 Boman Index: -2680
Half-Life: 1.3 hour Half-Life Yeast: 3 min
Half-Life E.Coli: 2 min Aliphatic Index 12.5
Instability Index: 5921.25 Extinction Coefficient cystines: 12490
Absorbance 280nm: 832.67

Literature

  • PubMed ID:  8134294
  • Title:  Gastrin and cholecystokinin in the Eastern Grey kangaroo, Macropus giganteus giganteus.